Notice: 10% Discount on Bitcoin Payment

IGF1-LR3 Peptide 1mg

£59.00

High-purity IGF1 LR3 1mg research peptide supplied as a lyophilised solid for advanced studies in cellular signalling and biochemistry. Manufactured to ≥98% purity, it ensures consistent and reliable performance for laboratory research use only.

Category Brand:

Description

IGF1 LR3 1mg – High-Quality Research Peptide

IGF1 LR3 (Long arginine 3-IGF-1) 1mg is a specialised research peptide designed for advanced studies in biochemistry and related scientific fields. At UK-Peptides Ltd, we supply this high-purity compound for laboratory use, ensuring precision, consistency, and reliability in controlled research environments.


What is IGF1 LR3?

IGF1 LR3 is a modified analogue of insulin-like growth factor studied in biochemical and cellular research. Scientists use it in laboratory settings to explore cellular signalling pathways and molecular interactions.

In addition, research into igf1 lr3 benefits and igf1 lr3 dosing continues to expand within experimental science.


IGF1 LR3 1mg Product Specifications

  • Product Name: IGF LR3 1mg
  • Catalogue Number: IGF1LR3-1mg
  • Molecular Weight: 9117.60 g/mol
  • Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Purity: ≥98%
  • Form: Lyophilised Solid

These specifications ensure igf1 lr3 meets strict research-grade standards for accuracy and reproducibility.


Research Applications of IGF1 LR3

Researchers actively use this peptide in various experimental studies, including:

  • Cellular growth and signalling research
  • Biochemical pathway analysis
  • Molecular interaction studies
  • Experimental biology investigations

Furthermore, its high purity supports consistent and reliable laboratory outcomes.


Usage and Storage Guidelines

We supply this products as a lyophilised solid to maintain stability and extend shelf life. Therefore, researchers should:

  • Store in a cool, dry environment
  • Follow proper laboratory reconstitution procedures
  • Handle according to standard research protocols

Additionally, detailed instructions are available on the official website.


Quality Assurance and Synthesis

At UK-Peptides Ltd, we synthesise the best peptide under strictly controlled conditions. As a result, each batch achieves ≥98% purity and consistent structural integrity.

Moreover, we conduct rigorous quality testing to ensure reliable performance in scientific research applications.


Why Choose UK-Peptides Ltd?

  • High-quality product for sale
  • Strict laboratory-grade quality control
  • Consistent batch performance
  • Trusted supplier for scientific research

In addition, we are committed to delivering dependable peptide solutions. Discover our range of products on our website: GHK-Cu 50mg , GHRP-2 , GHRP 2 Peptide ,Peptides for Sale, Hexarelin Peptides


Legal and Safety Information

This particular product is strictly intended for scientific research purposes only. Therefore:

  • Not for human consumption
  • Not for clinical or therapeutic use
  • Not for diagnostic applications

It must be handled only by qualified laboratory professionals.


Buy IGF1 LR3 Online

If you are looking to buy now, UK-Peptides Ltd provides a trusted source for high-quality research peptides.

Reviews

There are no reviews yet

Only logged in customers who have purchased this product may leave a review.

Related Products

Follistatin 1mg 95% Purity (Untagged Premium)
£70.00
Epitalon 10mg
£18.00
CJC-1295 With DAC 5mg
£40.00
Bronchogen 20mg
£35.00