LL-37 5mg

Description

LL-37 5mg – High-Quality Research Peptide

This peptide (5mg) is a specialised research compound designed for advanced scientific studies in immunology and microbiology. At uk-peptidesltd.com, we supply this high-purity peptide for laboratory use, ensuring consistency, reliability, and precision in research environments.

What is LL-37 Peptide?

This peptide is an antimicrobial peptide widely studied in immune system research and microbial biology. Scientists use it in controlled laboratory settings to investigate immune response mechanisms and cellular defence processes.

In addition, research into ll 37 peptide benefit continues to grow within experimental immunology and microbiology studies.

LL-37 5mg Product Specifications

• Product Name: LL-37 5mg
• Catalogue Number: LL37-5mg
• Molecular Formula: C205H340N60O53
• Molecular Weight: 4493.3 g/mol
• Sequence: [LL-37, 37 aa]
• Purity: ≥98%
• Form: Lyophilised Solid

These specifications ensure the ll-37 peptide meets strict research-grade standards for accuracy and reproducibility.

LL-37 Research Applications

Researchers actively use the ll-37 peptide in various scientific studies. For example, it is applied in:

• Immunology and immune response research
• Microbiology and antimicrobial studies
• Cellular defence mechanism research
• Host–pathogen interaction studies

Furthermore, its high purity supports consistent and reliable laboratory outcomes.

Storage and Handling

This peptide is supplied as a lyophilised solid to maintain stability and extend shelf life. Therefore, researchers should:

• Store in a cool, dry environment
• Follow proper laboratory reconstitution procedures
• Handle according to standard research protocols

Additionally, detailed guidance is available on the official website for proper laboratory use. Discover our range of products on our website: Ipamorelin ,Ipamorelin Peptide ,Kisspeptin-10 ,KPV 10mg ,KPV Peptide

Quality Assurance

At uk-peptidesltd.com, we synthesise  peptide under controlled conditions to ensure high purity (≥98%) and consistency. As a result, each batch delivers reliable performance for scientific research. Moreover, every product undergoes strict quality testing to meet laboratory-grade standards.

Why Choose uk-peptidesltd.com?

• High-quality peptide for sale
• Strict laboratory-grade quality control
• Reliable and consistent batch supply
• Trusted supplier for research peptides

In addition, we are committed to supporting advanced scientific research with dependable materials.

Legal and Safety Information

This peptide is strictly intended for scientific research purposes only. Therefore:

• Not for human consumption
• Not for clinical or therapeutic use
• Not for diagnostic applications

It must be handled only by qualified laboratory professionals.

Buy this product Peptide Online

If you are looking to get this product, uk-peptidesltd.com provides a trusted source for high-quality research compounds.